Back
Report | September 01, 2026

2026 State Session Recap Report

Strengthen your 2027 GA strategy with a state-by-state look at 2026 legislation: where it piled up, where it passed, and which policy topics dominated.

2026 State Session Recap Report
Anna van Erven

Policy Content Strategist

If you spent 2026 trying to keep up with the states, you know the problem isn't finding legislative activity…it's the flood of it!

We built this report to make that flood legible.

Using the PolicyNote API and MCP, we pulled every bill introduced and enacted in the 2026 state sessions, covering all 50 states and DC as of August 17, 2026. Then, we classified and analyzed the full set.

Part I asks

Where

Where was legislation introduced the most, and where did the most of it actually become law?

Part II asks

What

What policy topics dominated the legislation that actually passed, state by state?

This report isn't designed to  rank legislatures by quality or importance. It measures volume and conversion. A state that quietly enacted 400 bills may matter more to your issues than one that passed 1,200. Only you know which states and topics carry weight for your organization. Think of what follows as the map, not the route.

Executive Summary

Our analysis of the 2026 state legislative sessions found five things government affairs teams should carry into 2027 planning:

New Jersey introduced the most bills in 2026, but Texas enacted the most. This shows introduction volume and lawmaking output are very different rankings.

Conversion rates ranged from nearly 70% (Colorado) to 1.1% (Minnesota). Virginia, Louisiana, and Maryland combined high volume with high conversion, making them the states where activity most reliably becomes law.

Social policy dominated the year. Roughly three in 10 enacted bills across the top 15 states were Social, more than Healthcare and Finance combined.

Despite the headlines, Digital (AI, privacy, platform regulation) made up just 2.1% of enacted bills. In emerging policy areas, introductions run years ahead of enactments.

Some national-looking trends are really the result of one state.Virginia alone accounts for a quarter of all Energy enactments. Social, Healthcare, Finance, and Manufacturing were the genuinely broad-based categories, with no single state driving more than about 14% of any of them.

Part I: Which States Should I Pay Close Attention To?

Where should your team focus attention and relationship-building for 2027? The answer depends on both the scale of legislative activity and how often that activity becomes law.

Answering it takes three views of the same data, built in sequence:

  • Bills introduced tell you where the noise is
  • Bills enacted tell you where law is actually being made
  • How seriously to take an introduction before you know anything else about it

This section walks through all three. Notice how each chart reshuffles the map the last one drew.

Know When Every Statehouse Convenes in 2027

Our 2027 state legislative session calendar covers convene and adjournment dates for all 51 legislatures, checked daily. The same care we put into policy data, applied to your planning calendar.

Open the 2027 Calendar

Total Bills Introduced

Volume is your workload map. Before it says anything about politics, it tells you what your team is up against operationally.

Top 15 States by Bills Introduced (2026)

1New Jersey9,742
2Texas *7,274
3New York 5,326
4Mississippi3,600
5Minnesota 3,579
6Illinois 3,022
7Missouri2,892
8Oklahoma 2,590
9Hawaii 2,459
10Rhode Island2,455
11Tennessee 2,454
12Washington 2,399
13Virginia2,178
14Maryland2,128
15Massachusetts 2,110
Top 5 (ranks 1–5) Ranks 6–10 Bottom 5 (ranks 11–15)

* Biennial legislature (2025 session figures)  ·  † Carryover state (count reflects bills introduced in 2026 only). Data as of August 17, 2026. Source: PolicyNote.

What the data shows

  • New Jersey is a clear volume outlier, with 9,742 bills introduced, 34% more than Texas
  • Bill volume is not simply a function of state size: Mississippi ranks fourth, ahead of Illinois and California, even though it's smaller in size
  • The ranking above spans multiple legislative structures, including single-year, carryover, and biennial legislatures. Eight of the top 15 jurisdictions have formal bill-carryover rules

Total Bills Enacted

We can think of enactments as your obligations map; this is where new law actually got made in 2026.

Top 15 States by Bills Enacted (2026)

1Texas *1,206
2Virginia1,121
3Louisiana972
4Maryland881
5Montana *777
6Tennessee 659
7North Dakota *600
8Nevada *532
9Utah492
10Rhode Island478
11Oklahoma 447
12Colorado436
13New York 411
14Alabama402
15Mississippi376
Top 5 bills enacted Ranks 6–10 Bottom 5 bills enacted

Top 15 jurisdictions by bills enacted in 2026, as of August 17. Source: PolicyNote.

What the data shows

  • Texas and Virginia lead the country in enacted bills
  • While Louisiana and Maryland both rank outside the top 10 for introductions, they place third and fourth for enacted bills
  • Conversely, while New Jersey introduced the most bills, it yielded 280 enactments as of August 17
  • The gap between introduced and enacted volume is the key distinction: a large bill docket does not necessarily produce a correspondingly large body of enacted policy

Legislative Effectiveness

Effectiveness can tell you how seriously to take a bill at introduction. In a high-conversion state, introduction alone is a real signal.

A note about the data below: Some states give bills one year to pass; others let bills stay alive across a two-year session, giving them far more time to become law. So rather than one national ranking, we compare states in two separate groups. Within each group, the charts show where the largest share of introduced bills has become law as of August 17, 2026.

Legislative Effectiveness: Single-Year States (2026)

1Arkansas (96.7%)176 of 182
2Colorado (69.7%)436 of 626
3Louisiana (54.5%)972 of 1,784
4Utah (52.8%)492 of 931
5Virginia (51.5%)1,121 of 2,178
6Oregon (49.6%)142 of 286
7Idaho (47.5%)344 of 724
8South Dakota (42.0%)240 of 571
9Maryland (41.4%)881 of 2,128
10Wyoming (41.1%)107 of 260
11Alabama (38.3%)402 of 1,050
12Indiana (29.2%)162 of 555
13Rhode Island (19.5%)478 of 2,455
14Connecticut (16.7%)185 of 1,107
15Florida (15.8%)125 of 792
16Kentucky (14.9%)193 of 1,293
17Arizona (13.0%)264 of 2,030
18Mississippi (10.4%)376 of 3,600
19New Mexico (10.3%)71 of 686
20Missouri (2.9%) 84 of 2,892
21New Jersey (2.9%) 280 of 9,742
Top 5 conversion rates Ranks 6–16 Bottom 5 conversion rates

‡ Still in session  ·  Arkansas held a fiscal session limited largely to must-pass appropriations bills, which inflates its rate. Data as of August 17, 2026. Source: PolicyNote.

What the data shows

  • Arkansas held a short budget-only session in 2026, where nearly every bill is a must-pass spending measure. That's why its rate (96.7%) is so high. It's not comparable to states running full legislative sessions
  • Among full-policy single-year sessions, Colorado (69.7%), Louisiana (54.5%), Utah (52.8%), and Virginia (51.5%) converted roughly half or more of introduced bills into law
  • At the other end, Missouri and New Jersey stood at 2.9%

Legislative Effectiveness: Multi-Year States (2026)

1North Dakota (58.8%) *600 of 1,020
2Delaware (57.7%)305 of 529
3District of Columbia (55.3%) 310 of 561
4Nevada (53.0%) *532 of 1,003
5Montana (48.9%) *777 of 1,589
6Maine (39.6%)808 of 2,038
7California (34.6%) 777 of 2,247
8Georgia (33.4%)437 of 1,310
9Nebraska (30.0%)227 of 756
10West Virginia (29.8%)242 of 812
11New Hampshire (29.5%)604 of 2,045
12Kansas (24.3%)172 of 707
13Tennessee (22.6%)656 of 2,902
14Oklahoma (18.9%)587 of 3,101
15Texas (16.6%) *1,206 of 7,274
16South Carolina (14.8%)137 of 926
17Vermont (14.7%)100 of 679
18Washington (14.6%)406 of 2,776
19Alaska (14.1%)61 of 434
20Wisconsin (12.6%)203 of 1,613
21Hawaii (10.4%)329 of 3,172
22Ohio (10.0%) 98 of 976
23Iowa (9.1%)209 of 2,300
24New York (8.9%)1,428 of 16,078
25Illinois (8.3%)494 of 5,930
26North Carolina (7.5%) 131 of 1,755
27Michigan (4.4%) 97 of 2,210
28Pennsylvania (3.6%) 112 of 3,077
29Massachusetts (1.8%) 178 of 9,957
30Minnesota (1.1%)78 of 6,939
Top 5 effectiveness rates Ranks 6–25 Bottom 5 effectiveness rates

* Biennial legislature (2025 session figures)  ·  ‡ Still in session. Data as of August 17, 2026. Source: PolicyNote.

What the data shows

  • North Dakota leads the multi-year cohort (58.8%), converting more than half of its 2025 agenda into law. Delaware (57.7%) and DC (55.3%) follow, both carryover states; Nevada (53.0%) and Montana (51.3%) round out the top five
  • Minnesota (1.1%) is the lowest rate of all 30 jurisdictions, and with its session complete, that result is final
  • Massachusetts (1.8%), Pennsylvania (3.6%), Michigan (4.4%), and North Carolina (7.5%) round out the bottom five, but all four are still in session, so their rates are floors that may still rise

State Prioritization for 2027

The chart below brings the two halves of Part I together. Each dot is a state, placed by how many bills it introduced (left to right) and what share of those bills became law (bottom to top). Dashed lines mark the median on each measure, splitting the map into four quadrants

Bill Volume vs. Legislative Effectiveness (2026)

0%20%40%60%80%100%2005001,0002,0005,00010,000Bills introduced (log scale)Effectiveness rateMedian volume (1,589)Median rate (19.5%)ALAZARCOCTFLIDINKYLAMDMSMONJNMORRISDUTVAWYAKCADEGAHIILIAKSMEMAMIMNNENHNYNCOHOKPASCTNVTWAWVWIDCTXMTNDNV
Single-year states (21) Carryover states + DC (26) True biennial states (4)

Dashed lines mark the median bill volume and median effectiveness rate across all 51 jurisdictions. Biennial states use completed 2025 session figures. Data as of August 17, 2026. Source: PolicyNote.

Prioritize the “Double Threats”

Virginia, Louisiana, and Maryland combine substantial bill volume with strong same-year conversion, making these states a “double threat.” Virginia enacted 1,121 of 2,178 introduced bills (51.5%), Louisiana 972 of 1,784 (54.5%), and Maryland 881 of 2,128 (41.4%).

These are states where a large legislative agenda is also comparatively likely to become binding policy, making a strong case for treating them as core jurisdictions for sustained issue monitoring.

Treat the Megaproducers Differently

Texas (16.6%) and New York (8.9%) convert at low rates, closer to New Jersey (2.9%) than to the double threats above. But they don’t belong in the same bucket as New Jersey, and the difference is due to the total enacted bills they produce. New Jersey yielded 280 laws, whereas Texas yielded 1,206 (the most of any state in 2026) and New York’s 2025 cohort yielded 1,428, the largest of any multi-year jurisdiction.

For these states, filter aggressively, as you would in New Jersey, but staff for the volume of law that will emerge regardless. For Texas, which reconvenes in 2027, use the interim to review which committees and sponsors drove the 2025 session’s output before the next docket arrives.

Discount the Noise, But Don’t Ignore It

As the data shows, large bill dockets do not automatically result in equally large bodies of enacted policy.

Minnesota (1.1%) has the lowest rate of all 30 multi-year jurisdictions. New Jersey introduced more bills than any other jurisdiction (9,742) but had enacted just 280 (2.9%) as of August 17. Missouri (2.9%) and Massachusetts (1.8%) show the same pattern at a smaller scale. All three remain in session, but would need a large jump in enactments to approach double-threat territory before adjourning.

For these states with higher volume and lower enactments, the response is not to ignore them but to filter more deliberately. Weight alerts and review criteria toward your priority issues, leadership-sponsored measures, committee movement, companion bills, and other procedural indicators that separate bills with real momentum from the broader introduction volume.

Don’t Overlook the Quiet Converters

A smaller docket does not mean a smaller policy impact. Colorado (69.7%) introduced just 626 bills but enacted 436 of them. Utah (52.8%), North Dakota (58.8% *), Delaware (57.7%), and DC (55.3% ) show the same pattern: modest bill counts converting efficiently into law.

When bills are introduced in these states, they deserve attention, even though they are not the highest-volume legislatures.

Want to Filter This Analysis to Your Issues? 

This report was spot-checked and verified using the PolicyNote MCP, which brings live legislative data into the AI tools your team already uses, right alongside your own notes, priorities, and business data.

Explore the PolicyNote MCP

Part II: What Issues Are Hot?

Part I showed where legislative activity concentrates and where it actually becomes law. This section looks at what that law is about, specifically which policy topics dominated the national agenda in 2026.

We started with the 15 states that enacted the most bills. Together, produced roughly 60% of all legislation enacted nationwide.

We classified every bill in these states into the following policy categories to identify which states lean hardest into which categories. Bills are classified by primary topic, so an AI-in-hiring bill lands in Employment and Labor.

  1. Social
  2. Finance
  3. Energy, Environment, Sustainability
  4. Digital
  5. Food and Cosmetics
  6. Healthcare
  7. Manufacturing, Infrastructure, and Transport
  8. Employment and Labor
  9. Agriculture
  10. Trade
  11. Other: bills outside the 10 substantive categories

Enacted Bills by Policy Category (2026)

1Social2,976
2Healthcare1,195
3Finance807
4Manufacturing, Infrastructure, and Transport666
5Energy, Environment, Sustainability495
6Employment and Labor447
7Digital203
8Agriculture161
9Food and Cosmetics92
10Trade21
Other2,780

Bills enacted across the top 15 states by 2026 enacted volume. Other captures bills outside the 10 substantive categories and is shown for completeness, not ranked. Data as of August 17, 2026. Source: PolicyNote.

Social policy is the largest category

It’s larger than Healthcare and Finance combined, accounting for three in 10 enacted bills across these states. Part of that is due to breadth. The category spans education, criminal justice, housing, and elections, each a major legislative program on its own. Even so, its scale is the story: the citizen-facing core of state government is where statehouses spent their 2026 energy.

No topic passes at a dramatically higher rate than any other

Conversion rates range from 20% (Trade) to 36% (Agriculture), with most categories sitting in the low-to-high 20s. Social tops the ranking not because it passes more easily, but because legislators introduce far more of it: 11,859 Social bills, versus a 100 or so in categories like Trade. Volume of introductions, not the odds of any single bill passing, is what makes a topic “hot.”

Digital is surprisingly low

This category, covering AI, privacy, and platform regulation, ranks eighth of 11, at just 2.1% of enacted bills. That’s not because AI legislation is scarce; introductions are plentiful. It’s that comparatively few have become law so far, a reminder that in emerging policy areas, the noise runs years ahead of the statute books. (Two caveats: bills are classified by primary topic, so AI provisions inside healthcare land in the healthcare category. Also, California, the most active digital-policy state, falls outside this 15-state sample.)

The 2026 Laws That Could Shape 2027

Join us September 24 as our policy analysts walk through the 2026 state bills GA teams should have on their radar heading into next year.

Register today

Issue Mix by State

This chart breaks each state's enacted bills into shares by category, showing whether its 2026 agenda concentrated in a few issues or spread across the board.

Policy Category Mix by State (2026)

Texas *29%12%7%7%9%29%
Virginia37%15%8%11%9%14%
Louisiana30%11%7%10%10%30%
Maryland31%14%11%12%23%
Montana *33%11%7%8%10%25%
Tennessee 34%11%7%35%
North Dakota *26%12%12%33%
Nevada *32%17%7%9%26%
Utah35%11%9%8%10%20%
Rhode Island28%11%12%9%32%
Oklahoma 30%13%9%7%32%
Colorado32%13%8%10%26%
New York 21%12%7%9%11%35%
Alabama23%12%7%44%
Mississippi18%14%48%
Social Healthcare Finance Manufacturing, Infrastructure, and Transport Energy, Environment, Sustainability Other substantive Other

Share of each state’s 2026 enacted bills by policy category. States ordered by bills enacted. Other substantive combines Employment and Labor, Digital, Agriculture, Food and Cosmetics, and Trade. Segments under 7% are unlabeled. * Biennial legislature (2025 session figures)  ·  † Carryover state. Data as of August 17, 2026. Source: PolicyNote.

What the data shows

Social is the top substantive category in every one of the 15 states, but how dominant it is varies widely. Virginia leans into it hardest, with 37% of its enacted bills falling under Social. New York and Mississippi also lead with Social, but far less dominantly, at under a quarter of their totals, and their agendas spread more evenly across everything else.

The other categories are where states set themselves apart. Every state enacted bills in at least 10 of the 11 categories; what varies is how much weight each one gives an issue.

  • Nevada's Healthcare share (17%) is the highest of any state in any secondary category,
  • Virginia's Energy, Environment, and Sustainability share (11%) is unusually high for a category that barely registers elsewhere
  • Maryland and Rhode Island both lean into Finance at 11–12%
  • In North Dakota, 5% of its enacted bills are Agriculture, nearly double any other state in the top 15

Who's Leading Each Priority Topic

This section ranks all 15 states by enacted-bill count in each of the five largest substantive categories — Social, Healthcare, Finance, Manufacturing, and Energy — so you can see who leads each priority topic, and by how much. 

Social: Enacted Bills by State (2026)

1Virginia415
2Texas *356
3Louisiana295
4Maryland277
5Montana *255
6Tennessee 222
7Nevada *171
8Utah171
9North Dakota *154
10Colorado139
11Oklahoma 133
12Rhode Island132
13New York 97
14Alabama92
15Mississippi67

2,976 bills enacted in this category across the top 15 states by 2026 enacted volume. *Biennial legislature (2025 session figures)  ·  † Carryover state. Data as of August 17, 2026. Source: PolicyNote.

Healthcare: Enacted Bills by State (2026)

1Virginia166
2Texas *150
3Maryland120
4Louisiana106
5Nevada *90
6Montana *87
7North Dakota *74
8Tennessee 72
9Oklahoma 59
10Utah56
11Colorado55
12Rhode Island54
13New York 54
14Alabama27
15Mississippi25

1,195 bills enacted in this category across the top 15 states by 2026 enacted volume.
* Biennial legislature (2025 session figures)  ·  † Carryover state
Data as of August 17, 2026. Source: PolicyNote.

Finance: Enacted Bills by State (2026)

1Maryland94
2Texas *88
3Virginia72
4Louisiana69
5Rhode Island58
6Montana *57
7Mississippi54
8Alabama50
9Utah45
10Tennessee 40
11Oklahoma 40
12Nevada *38
13North Dakota *36
14Colorado33
15New York 33

807 bills enacted in this category across the top 15 states by 2026 enacted volume.
* Biennial legislature (2025 session figures)  ·  † Carryover state
Data as of August 17, 2026. Source: PolicyNote.

Manufacturing, Infrastructure, and Transport: Enacted Bills by State (2026)

1Louisiana96
2Texas *88
3Virginia88
4Montana *60
5Maryland44
6Rhode Island42
7Tennessee 38
8North Dakota *36
9Utah34
10Nevada *30
11Oklahoma 25
12New York 25
13Colorado22
14Mississippi20
15Alabama18

666 bills enacted in this category across the top 15 states by 2026 enacted volume.
* Biennial legislature (2025 session figures)  ·  † Carryover state
Data as of August 17, 2026. Source: PolicyNote.

Energy, Environment, Sustainability: Enacted Bills by State (2026)

1Virginia123
2Texas *59
3Montana *49
4Utah41
5New York 41
6Maryland38
7North Dakota *31
8Colorado30
9Louisiana17
10Nevada *17
11Oklahoma 15
12Rhode Island9
13Mississippi9
14Tennessee 8
15Alabama8

495 bills enacted in this category across the top 15 states by 2026 enacted volume.
* Biennial legislature (2025 session figures)  ·  † Carryover state
Data as of August 17, 2026. Source: PolicyNote.

What the data shows

  • Virginia leads three of the five categories — Social (415), Healthcare (166), and Energy, confirming its "double threat" status from Part I isn't built on any single issue
  • No other category has a gap like Virginia's Energy lead: 123 enacted bills, more than double second-place Texas (59)
  • Maryland tops Finance (94), no surprise after seeing Finance claim a bigger share of Maryland's output than of almost any other state's
  • Louisiana leads Manufacturing, Infrastructure, and Transport (96)
  • Texas, the overall enactment leader, finishes second in four of five categories but first in none

Which Trends Are Actually National?

For 2027 planning, the remaining question is which of those categories reflect a genuine cross-state trend and which are one state's priority wearing a national label.

Every category shows up in all 15 states except Trade

Trade appears in just 9 and totals only 21 enacted bills — too thin to treat as a monitoring priority.

Showing up everywhere doesn’t mean the activity is evenly spread

Social, Healthcare, Finance, and Manufacturing are both large and genuinely broad-based: no single state accounts for more than about 14% of any of their totals. A shift in one of these categories signals something happening across multiple states.

Energy and Agriculture look national but aren’t quite

Virginia’s outsized Energy lead means it alone accounts for a quarter of the group’s Energy total, and North Dakota’s Agriculture tilt makes it 17% of that category. A trend line in either is more likely to be one state’s push than a multi-state shift.

Digital, small as it is, passes the breadth test

All 15 states enacted digital bills and none accounts for more than 18%. So, the activity is thin but national.

Next Steps

The 2026 picture isn't quite finished: several legislatures are still in session, and the four biennial states return in January. The map will look different by spring, and the teams that plan for that shift now will be ahead of it.

About PolicyNote

Analysis like this is only as good as the data underneath it. PolicyNote, FiscalNote's policy intelligence platform, is built on the same legislative data this report draws from: every bill in every state, tracked in real time and available through the platform or the API we used here. That's the foundation for strategy you can defend, whether you're building a 2027 monitoring plan or an analysis of your own.

When your issues reach Washington, CQ News and Roll Call add expert reporting and analysis of federal legislation and what's actually happening on the Hill, so your team isn't interpreting Congress alone.

And when it's time to act on what you're seeing, VoterVoice, our advocacy platform, turns monitoring into mobilization, connecting your supporters with the officials who need to hear from them.

Methodology & Terminology

Expand any section below for detail on how the figures in this report were built.

We built a custom data pipeline on the PolicyNote API to pull and classify every bill from the 2026 sessions, then ran the analysis behind the charts in this report. As we wrote, we used the PolicyNote MCP server to spot-check and verify figures against live data. All figures reflect bill status as of August 17, 2026. Legislative data is live, and several legislatures can still add to their totals: New Jersey, Michigan, Ohio, Pennsylvania, and DC remain in regular session through late 2026; California and North Carolina run through August 31; Massachusetts continues informal sessions; and Missouri holds a veto session in September. These states are marked with ‡ in the charts, and their figures represent a floor rather than a final count.

Bills only: resolutions, memorials, and amendments are excluded. Coverage is all 50 states plus DC. Figures reflect each state's regular session, with one exception: Virginia's totals include carryover legislation from its December 2025 special session, including the FY2027 budget, that was enacted in 2026. Excluding those bills would understate what Virginia's legislature actually produced this cycle. Where states allow bills to be pre-filed ahead of a session, those bills are counted with the session they belong to.

The 51 jurisdictions fall into 3 groups. 21 single-year states start each session fresh: bills introduced in 2026 either pass in 2026 or die. 25 carryover states plus DC run 2-year sessions in which bills introduced in 2025 remain alive in 2026, marked with † in the charts. 4 biennial states (Texas, Montana, North Dakota, Nevada) held their regular sessions in 2025 and are reported with completed 2025 session figures, marked with *.

Effectiveness is bills enacted divided by bills introduced, within the same cohort. For single-year states, that is bills introduced and enacted in 2026. For multi-year jurisdictions, the rate follows the 2025 cohort: bills introduced in 2025 and enacted to date. Cohort counts can therefore differ from the 2026-only volume counts in the introduced and enacted rankings, by design. The two groups use different cohorts by necessity and are not directly comparable.

Every bill was classified into 1 of 10 substantive policy categories or Other, using an AI model applying a consistent prompt across all states. Each bill receives exactly one category based on its primary topic, so a bill touching several areas is counted once, under its dominant one. Other captures bills outside the 10 categories, mostly appropriations, local, and procedural measures, and is shown for completeness, not ranked as a finding. Arkansas is a special case: its 2026 fiscal session is limited largely to per-agency appropriations bills, which classify as Other and inflate both its effectiveness rate and its Other share.

 * biennial state (2025 session figures) · † carryover state · ‡ still in session as of August 17, 2026